finding items/comparison in/with a dictionary - Printable Version +- Python Forum (https://python-forum.io) +-- Forum: Python Coding (https://python-forum.io/forum-7.html) +--- Forum: General Coding Help (https://python-forum.io/forum-8.html) +--- Thread: finding items/comparison in/with a dictionary (/thread-9259.html) Pages:
1
2
|
finding items/comparison in/with a dictionary - AGC - Mar-29-2018 Hello, I have file 1 with this kind of information: Name Definition for about 2,000 names --> I have created a dictionary with this file (name:definition) I have file 2 with this kind of information: >Name \n Information about name for the same 2,000 names The goal is to add the definition of file 1 to the correct name in file 2: >Name Definition \n Information I generated the code below where it is supposed to verify if the name is the same as in the dictionary: if line(name) in dict.keys() and it doesn't seem to work. I have printed separately line(name) and dict.keys() and they are the same list of characters,except for that when I print the dictionary it adds brackets as in ['name']. (I also know that I make my code more complicated than it should be ... I need to learn how to generate functions!) file1= open('c:/python27/annotation.txt', 'r') dict={} file2= open('c:/python27/protein_file.faa', 'r') outfile=open('c:/python27/proteinandannotation.faa', 'w') for line in file1: name=line.strip().split() dict={name[0]:name[1:]} for line in file2: if line.startswith('>'): # line=line.strip if line[1:28] in dict.keys(): line=line.strip('\n') outfile.write(line + dict.values() + '\n') else: outfile.write(line) RE: finding items/comparison in/with a dictionary - woooee - Mar-29-2018 Print what you are comparing so you know what is happening. Also Python uses dict already so name your dictionaries something else. print("\n", line[1:28]) print(dict.keys) if line[1:28] in dict.keys(): RE: finding items/comparison in/with a dictionary - AGC - Apr-02-2018 Thanks! I figured that I had to strip the return line character at the end; THis is my new code: for key in annotation: for line in file2: if line.startswith('>'): gene=line[1:] gene=gene.strip('\n') if gene == key: for loop not loopng through dictionary - AGC - Apr-02-2018 Hello, I have file 1 with this kind of information: "ID" "Definition" for about 2,000 IDs --> I have created a dictionary with this file (id:definition) --> dictionary is called annotation(name1:name2) I have file 2 with this kind of information: ">" + "ID" + \n + "Information about ID" for the same 2,000 IDs The goal is to add the definition of file 1 to the correct ID in file 2: ">" + "ID" + "Definition" + \n + "Information about ID" I generated the code below where it is supposed to verify if the name is the same as in the dictionary: however it only checks the first entry in the dictionary. file1= open('c:/python27/annotation.txt', 'r') #this has the ID and definition annotation={} #define the dictionary file2= open('c:/python27/protein_file.faa', 'r') #this has the ID with information outfile=open('c:/python27/proteinandannotation.faa', 'w') for line in file1: #here I populate the dictionary with ID:definition name=line.strip().split() annotation={name[0]:name[1:]} print annotation #the entire dictionary prints, so it is all there for key in annotation: #here I go through every key in the dictionary, but it only seems to go through 1 print key #all the keys print for line in file2: #will check this file for the first line of each entry with the ">" +"ID" format print key #only the first key prints now if line.startswith('>'): #here I make sure that I am on the line with ID gene=line[1:] #here I extract ID from line gene=gene.strip('\n') #and get rid of line return if gene == key: #here I compare the ID to the key value in the dictionary; it works well for 1 line=line.strip('\n') outfile.write(line + str(annotation[key]) + '\n') #here I write the ID with the definition else: outfile.write(line) #If the line doesn't have an Id and it is just the information I just write it RE: for loop not loopng through dictionary - buran - Apr-02-2018 on line#7 with each iteration you overwrite existing annotation dict with a new one with single element Apart from that your approach is ineffective. better approach would be to loop trough file 1 and create a dict. then iterate over file 2, reading 2 lines (there are different possible approaches to do this), parse them to extract ID and info, then just get the respective element from the dict, created from file 1 and write to new file (file 3) Not to mention that lines 19-20 will print lines that not start with > many many times RE: for loop not loopng through dictionary - buran - Apr-02-2018 Can you upload sample of the files? RE: finding items/comparison in/with a dictionary - AGC - Apr-02-2018 Thanks for your time and help. Here is a bit of file 1 with ID plus definitions: fig|6666666.213038.peg.1 Name=Leucyl-tRNA synthetase (EC 6.1.1.4) Ontology_term=KEGG_ENZYME:6.1.1.4 fig|6666666.213038.peg.2 Name=hypothetical protein fig|6666666.213038.peg.3 Name=peptidoglycan-associated lipoprotein%2C OmpA family fig|6666666.213038.peg.4 Name=Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4) Ontology_term=KEGG_ENZYME:3.1.22.4 fig|6666666.213038.peg.5 Name=FIG000859: hypothetical protein YebC fig|6666666.213038.peg.6 Name=Phage protein A bit of file 2, with >ID plus info about ID (this is a biology file) >fig|6666666.213038.peg.1 MQPNGVDLYVGGAEHAVLHLLYARFWHKVLYDYGYVSTPEPFYKLFHQGLILGEDGRKMS KSLGNVVNPDEVVQKYGADSLRMFEMFLGPLQDTKPWSTTGIEGINRFLNRIWRLFIDEN GNLNPNIEDLPLTPEQEYILHSTIKKVTEDIENLRFNTAIAQMMIFVNEFYKFEKKPKEA LKKFLLILAPFAPHISEELWHKLGYSESIFTYSFPEFDEHKAIKKEVEIVVQINSKIRAR INVPIDTPENEVLDIAKSEPNVQKYLAGKEIRKVIFVPNKILNIII >fig|6666666.213038.peg.2 MIIPFQFIQNLQKYNKNFCSKNIDKHFQNKFTREMSLSLYFEIYVKFFC >fig|6666666.213038.peg.3 MIYRNXFTIIFAVIFLSVSLLSAKPNXKSSKTENASEQYFLWGXVIEDANSPNTPNTPTQ DQPQIFDKSKIRIINLGPVVNWKGLDYAPTISADGKTLYFVSNRPGSKINPKTDKPSHDF WATKKNDRLDTIFFKPFNIDTTTIWGYQGVNTPENEGVASIAADGQTLYFTACSRPDGFG DCDIYKTTIEGDKWSRPYNLGPNVNSKYFDAQPSIAPDQSRLYFVSTRPGPNSDGNNENW DNMDIWYSDFDPETEEWLPAKNLTEINTPVQDCGPFIAADNQTLFFSSKGHQPNYGGLDF YVTRYDPVTKKWSKPENLGIPLNTPQDDQFITLPASGDVLYFSSRRKDIPGYQGDFDIFM AFVPSYFRAVVVKTTVIDECSGENIPAIVTIKSPIINRVVVDTLKATRTEIDFVVSNTDY GDPRDSIKFVNLEITAENPKYGKTTKIVRVDKPKPTTDPEEAKKYADVINVVIPLGQRPV IGAEIEEAKYVAENKKIKPEIANFRGLVMEQFQTWDLYPLLNYVFFDAGSSKIPDRYILF KSPDDKFKKAFTDTTIRGGTLEKYYHILNIYGYRLNKYPEAKIEIVGCNDGKTPEEKRPN LSKERAEAVFKYLRDVWGIDEKRMKITVRNQPAVVSNLNDSLGIVENRRVEILCNDWNIM KPVFDKDPKTFPQPETMNFTLKNGIEDALVKARRIEVKRGGREWNTLKDIGVVENKYTWD WKSSEGEYPKDEVPFTAQLIVTTINDKECSSDPIMIPVMQVTTEQKKVDIQKGAKDSTIE RYSLILFPFDRSDAGPINERIMREYVYNRVLPTSYVEVVGHTDVVGLYEHNQALSERRAT TVYNGIMQQTKGKVGYINKRGVGEDEPLYDNSLPEGRFYNRTVQVIIKTPVESWEQLGGG K >fig|6666666.213038.peg.4 MLILGIDPGSVKCGFGIVDFEGFPPKIIKVGLIRPKFKDKFHFLDKLKFIYDELNSLLDY FDIVETAVESQFYSKNPQSLMKLTQAKTVVELAMLNRNIPVFEYSPREIKLAITGRGGAT KKSVQYMVESIFDVNLKNKTTDISDALAVALCHISRKVNLNTKRNSPRNWREFVQMNPER VISQ And this is what I get with my code. It works beautifully with the first entry, but then since it is only looking at the first key it never matches with the ID and doesn't print it >fig|6666666.213038.peg.1['Name=Leucyl-tRNA', 'synthetase', '(EC', '6.1.1.4)', 'Ontology_term=KEGG_ENZYME:6.1.1.4'] MQPNGVDLYVGGAEHAVLHLLYARFWHKVLYDYGYVSTPEPFYKLFHQGLILGEDGRKMS KSLGNVVNPDEVVQKYGADSLRMFEMFLGPLQDTKPWSTTGIEGINRFLNRIWRLFIDEN GNLNPNIEDLPLTPEQEYILHSTIKKVTEDIENLRFNTAIAQMMIFVNEFYKFEKKPKEA LKKFLLILAPFAPHISEELWHKLGYSESIFTYSFPEFDEHKAIKKEVEIVVQINSKIRAR INVPIDTPENEVLDIAKSEPNVQKYLAGKEIRKVIFVPNKILNIII MIIPFQFIQNLQKYNKNFCSKNIDKHFQNKFTREMSLSLYFEIYVKFFC MIYRNXFTIIFAVIFLSVSLLSAKPNXKSSKTENASEQYFLWGXVIEDANSPNTPNTPTQ DQPQIFDKSKIRIINLGPVVNWKGLDYAPTISADGKTLYFVSNRPGSKINPKTDKPSHDF WATKKNDRLDTIFFKPFNIDTTTIWGYQGVNTPENEGVASIAADGQTLYFTACSRPDGFG DCDIYKTTIEGDKWSRPYNLGPNVNSKYFDAQPSIAPDQSRLYFVSTRPGPNSDGNNENW DNMDIWYSDFDPETEEWLPAKNLTEINTPVQDCGPFIAADNQTLFFSSKGHQPNYGGLDF YVTRYDPVTKKWSKPENLGIPLNTPQDDQFITLPASGDVLYFSSRRKDIPGYQGDFDIFM AFVPSYFRAVVVKTTVIDECSGENIPAIVTIKSPIINRVVVDTLKATRTEIDFVVSNTDY GDPRDSIKFVNLEITAENPKYGKTTKIVRVDKPKPTTDPEEAKKYADVINVVIPLGQRPV IGAEIEEAKYVAENKKIKPEIANFRGLVMEQFQTWDLYPLLNYVFFDAGSSKIPDRYILF KSPDDKFKKAFTDTTIRGGTLEKYYHILNIYGYRLNKYPEAKIEIVGCNDGKTPEEKRPN LSKERAEAVFKYLRDVWGIDEKRMKITVRNQPAVVSNLNDSLGIVENRRVEILCNDWNIM KPVFDKDPKTFPQPETMNFTLKNGIEDALVKARRIEVKRGGREWNTLKDIGVVENKYTWD WKSSEGEYPKDEVPFTAQLIVTTINDKECSSDPIMIPVMQVTTEQKKVDIQKGAKDSTIE RYSLILFPFDRSDAGPINERIMREYVYNRVLPTSYVEVVGHTDVVGLYEHNQALSERRAT TVYNGIMQQTKGKVGYINKRGVGEDEPLYDNSLPEGRFYNRTVQVIIKTPVESWEQLGGG K MLILGIDPGSVKCGFGIVDFEGFPPKIIKVGLIRPKFKDKFHFLDKLKFIYDELNSLLDY FDIVETAVESQFYSKNPQSLMKLTQAKTVVELAMLNRNIPVFEYSPREIKLAITGRGGAT KKSVQYMVESIFDVNLKNKTTDISDALAVALCHISRKVNLNTKRNSPRNWREFVQMNPER VISQ MSGHSKWANIKHKKAAKDAKRGKLFTRLAKEITIAAREGGGDPEANPRLRLAIQNAKAEN MPMENIKRAIQRGTGEIQGENYEEVIYEGYAPLGVAVILEAITDNRNRTYPLIRSEVNKL GGSIGEPGSVMWNFTRKGVIYIDPQGLTEEQMLEHILEAGCEDMEYDEERTRVICAFEDM VACQKYFEDKKFKILESKFEYIPKTTVKIDNIEAARKVLKFFDTLEELDDVQNVYGNYEF TDEVLSQLEKEQN RE: finding items/comparison in/with a dictionary - buran - Apr-02-2018 do the files have headers? Am I right that delimiter in first file is | ?
RE: finding items/comparison in/with a dictionary - AGC - Apr-02-2018 Nope, no headers. I am not sure what you mean by delimiter. The first ID (key) would be: fig|6666666.213038.peg.1 and the first definition (value): Name=Leucyl-tRNA synthetase (EC 6.1.1.4) Ontology_term=KEGG_ENZYME:6.1.1.4 RE: finding items/comparison in/with a dictionary - buran - Apr-02-2018 Also, in the second file this: [inline]MQPNGVDLYVGGAEHAVLHLLYARFWHKVLYDYGYVSTPEPFYKLFHQGLILGEDGRKMS KSLGNVVNPDEVVQKYGADSLRMFEMFLGPLQDTKPWSTTGIEGINRFLNRIWRLFIDEN GNLNPNIEDLPLTPEQEYILHSTIKKVTEDIENLRFNTAIAQMMIFVNEFYKFEKKPKEA LKKFLLILAPFAPHISEELWHKLGYSESIFTYSFPEFDEHKAIKKEVEIVVQINSKIRAR INVPIDTPENEVLDIAKSEPNVQKYLAGKEIRKVIFVPNKILNIII[/inline] is a single line or multiple lines? Can you attach the files? |